specialistfreightnetworks.com Report : Visit Site


  • Ranking Alexa Global: # 8,866,918

    Server:Microsoft-IIS/7.5...
    X-Powered-By:ASP.NET

    The main IP address: 109.228.0.18,Your server United Kingdom,Gloucester ISP:Fasthosts Internet Limited - UK's largest web hosting company  TLD:com CountryCode:GB

    The description :member login * * exclusive non-exclusive * home about members join meetings news testimonials gallery quote contact ☰ home about members join ▾ ▾ benefits specialist ▸ ▾ air sea general project non-ex...

    This report updates in 17-Jul-2018

Created Date:2011-12-28
Changed Date:2015-03-21

Technical data of the specialistfreightnetworks.com


Geo IP provides you such as latitude, longitude and ISP (Internet Service Provider) etc. informations. Our GeoIP service found where is host specialistfreightnetworks.com. Currently, hosted in United Kingdom and its service provider is Fasthosts Internet Limited - UK's largest web hosting company .

Latitude: 51.86568069458
Longitude: -2.2430999279022
Country: United Kingdom (GB)
City: Gloucester
Region: England
ISP: Fasthosts Internet Limited - UK's largest web hosting company

the related websites

HTTP Header Analysis


HTTP Header information is a part of HTTP protocol that a user's browser sends to called Microsoft-IIS/7.5 containing the details of what the browser wants and will accept back from the web server.

Content-Length:29519
X-AspNet-Version:4.0.30319
X-Powered-By:ASP.NET
Server:Microsoft-IIS/7.5
Cache-Control:private
Date:Tue, 17 Jul 2018 07:45:17 GMT
Content-Type:text/html; charset=utf-8

DNS

soa:ns0.rits-ds.co.uk. andy.realit-solutions.co.uk. 2018071201 7200 3600 604800 86400
ns:ns0.rits-ds.co.uk.
ns1.rits-ds.co.uk.
ipv4:IP:109.228.0.18
ASN:8560
OWNER:ONEANDONE-AS Brauerstrasse 48, DE
Country:GB
mx:MX preference = 1, mail exchanger = mailserver.specialistfreightnetworks.com.

HtmlToText

member login * * exclusive non-exclusive * home about members join meetings news testimonials gallery quote contact ☰ home about members join ▾ ▾ benefits specialist ▸ ▾ air sea general project non-exclusive apply now meetings ▾ ▾ sfn meetings past meetings news testimonials gallery quote welcome to sfn specialist freight networks, iso 9001 certified, links together 255+ elite freight forwarders in 113 countries. based in london, uk, sfn exists to facilitate the safe and profitable exchange of business between all members. watch our members' positive endorsement: general air sea project non-exclusive (we use cookies to enhance functionality and to better understand customer requirements. see our privacy policy for full details). watch video » click here latest news sfn secure new iso alliance... sfn member in portugal receives certificate of excellency... sfn members in italy launch new courier service... sfn raises funds for ave maria foundation in spain... sfn member in turkey ships shares heavy cargo and project shipments... sfn member in italy ships prefabricated houses to niger... sfn member in canada handle breakbulk cargo project... sfn member in italy handles specialised project from france... sfn member in netherlands opens new warehouse... sfn member in brazil recieves 6 trophies in infraero’s logistics efficiency awa... sfn member in malaysia moves heavy and sensitive cargo... sfn member in argentina celebrates 21 years... sfn member in sweden shares latest shipments... sfn member in malaysia ships sensitive cargo... special shipments by sfn member in malaysia... sfn member in uk celebrates 10th anniversary... sfn members cooperate for un projects... sfn member in germany unveils new website... sfn member ships private jet from singapore to usa... sfn member in brazil shares ecological tree planting scheme... sfn us member celebrates 15 years in business... sfn raises funds for father ray foundation in pattaya... seatrans agencies india reports success... prospect of business growing year on year... sfn member in canada completes complex project... tfw jordan shares oil & gas and renewable energy projects... sfn member in italy included in safmarine passport initiative... sfn member in indonesia moves mining machinery parts... sfn member in oman boasts great facilities... business is obtained and reciprocated at sfn... sfn member in germany completes project shipment to usa... sfn member in malaysia complete project shipment to oman... sfn member in netherlands celebrate 10th anniversary... 7 shipments secured within 45 days’ membership at sfn... sfn members cooperate on time sensitive shipment... sfn members in the netherlands and germany collaborate... sfn achieves iso 9001:2015 certification... sfn member in china completes shipments for uasc,cma and cosco... sfn member in bulgaria handles dangerous goods shipment... sfn member in bulgaria completes high valued shipment... sfn member in italy announces new airfreight consol service... sfn members endorse specialist freight networks... sfn member in turkey supports children's charity unicef... sfn member in turkey moves fire trucks and cement factory... sfn members shout loudly & proudly:... sfn member in poland moves 184 trailers, 57 tractors, 15 bulldozers... sfn member handles freight for new york city coffee festival... caspi freight believe in specialist freight networks ... sfn member in china celebrate 10th anniversary... sfn member opens news offices in china... multiple country representation: strong companies at sfn... sfn member in uae enjoys iftar gathering with industry veterans... sfn member in singapore moves tunnel boring machine... sfn member in uae signs exclusive contract with ethiopian airlines... logimar in italy recently shared details of a shipment to maputo, mozambique.... team building the sfn way: martial arts kick ass moves... sfn featured on azfreight.com... sfn members in usa share latest shipments with... sfn member in portugal celebrates 15 years... sfn member moves 60 cultural atrifacts from the vatican to taiwan... sfn member in lebanon announce new service... sfn member in malaysia share latest successes... sfn auction & raffle 2016... sfn members in uae reveal redesigned website... sfn members enjoy visit to south africa... sfn member in brazil sponsors golf tournament... sfn's 3rd member meeting outstanding success... sfn member in canada shares latest traffic... acw interview with sfn managing director kelly bunyan... sfn member in the netherlands moves to improved office space... sfn member at cargo logistica canada... sfn member in bulgaria shares latest shipments... sfn member in turkey share project photos... sfn member in china celebrates 19th anniversary... sfn member in usa continues to develop within sfn... sfn member consulted on chemical supply chain solutions... sfn member in the uk transports high end cars... » view all application form » click here sfn benefits » click here quote request » click here join sfn » click here about join quote sfn members code of conduct terms of use privacy © 2012 specialist freight networks

URL analysis for specialistfreightnetworks.com


https://www.specialistfreightnetworks.com/default.aspx/news/news.aspx?pname=&newsid=1858
https://www.specialistfreightnetworks.com/default.aspx/sfn-members/5/
https://www.specialistfreightnetworks.com/default.aspx/news/news.aspx?pname=&newsid=2179
https://www.specialistfreightnetworks.com/default.aspx/meetings/56/
https://www.specialistfreightnetworks.com/default.aspx/news/news.aspx?pname=&newsid=1853
https://www.specialistfreightnetworks.com/default.aspx/news/news.aspx?pname=&newsid=1854
https://www.specialistfreightnetworks.com/default.aspx/news/news.aspx?pname=&newsid=1855
https://www.specialistfreightnetworks.com/default.aspx/news/news.aspx?pname=&newsid=1856
https://www.specialistfreightnetworks.com/default.aspx/news/news.aspx?pname=&newsid=1857
https://www.specialistfreightnetworks.com/default.aspx/sfn-sea-exclusive/12/
https://www.specialistfreightnetworks.com/default.aspx/news/news.aspx?pname=&newsid=2071
https://www.specialistfreightnetworks.com/default.aspx/news/news.aspx?pname=&newsid=2177
https://www.specialistfreightnetworks.com/default.aspx/news/news.aspx?pname=&newsid=1928
https://www.specialistfreightnetworks.com/default.aspx/general/15/
https://www.specialistfreightnetworks.com/default.aspx/welcome-to-sfn/1/

Whois Information


Whois is a protocol that is access to registering information. You can reach when the website was registered, when it will be expire, what is contact details of the site with the following informations. In a nutshell, it includes these informations;

Domain Name: SPECIALISTFREIGHTNETWORKS.COM
Registry Domain ID: 1694205215_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.123-reg.co.uk
Registrar URL: http://www.meshdigital.com
Updated Date: 2015-03-21T02:10:42Z
Creation Date: 2011-12-28T09:36:36Z
Registry Expiry Date: 2018-12-28T09:36:36Z
Registrar: 123-Reg Limited
Registrar IANA ID: 1515
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS0.RITS-DS.CO.UK
Name Server: NS1.RITS-DS.CO.UK
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-14T15:37:09Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.

  REGISTRAR 123-Reg Limited

SERVERS

  SERVER com.whois-servers.net

  ARGS domain =specialistfreightnetworks.com

  PORT 43

  TYPE domain

DOMAIN

  NAME specialistfreightnetworks.com

  CHANGED 2015-03-21

  CREATED 2011-12-28

STATUS
clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
clientTransferProhibited https://icann.org/epp#clientTransferProhibited
clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited

NSERVER

  NS0.RITS-DS.CO.UK 81.201.128.197

  NS1.RITS-DS.CO.UK 81.201.143.197

  REGISTERED yes

Go to top

Mistakes


The following list shows you to spelling mistakes possible of the internet users for the website searched .

  • www.uspecialistfreightnetworks.com
  • www.7specialistfreightnetworks.com
  • www.hspecialistfreightnetworks.com
  • www.kspecialistfreightnetworks.com
  • www.jspecialistfreightnetworks.com
  • www.ispecialistfreightnetworks.com
  • www.8specialistfreightnetworks.com
  • www.yspecialistfreightnetworks.com
  • www.specialistfreightnetworksebc.com
  • www.specialistfreightnetworksebc.com
  • www.specialistfreightnetworks3bc.com
  • www.specialistfreightnetworkswbc.com
  • www.specialistfreightnetworkssbc.com
  • www.specialistfreightnetworks#bc.com
  • www.specialistfreightnetworksdbc.com
  • www.specialistfreightnetworksfbc.com
  • www.specialistfreightnetworks&bc.com
  • www.specialistfreightnetworksrbc.com
  • www.urlw4ebc.com
  • www.specialistfreightnetworks4bc.com
  • www.specialistfreightnetworksc.com
  • www.specialistfreightnetworksbc.com
  • www.specialistfreightnetworksvc.com
  • www.specialistfreightnetworksvbc.com
  • www.specialistfreightnetworksvc.com
  • www.specialistfreightnetworks c.com
  • www.specialistfreightnetworks bc.com
  • www.specialistfreightnetworks c.com
  • www.specialistfreightnetworksgc.com
  • www.specialistfreightnetworksgbc.com
  • www.specialistfreightnetworksgc.com
  • www.specialistfreightnetworksjc.com
  • www.specialistfreightnetworksjbc.com
  • www.specialistfreightnetworksjc.com
  • www.specialistfreightnetworksnc.com
  • www.specialistfreightnetworksnbc.com
  • www.specialistfreightnetworksnc.com
  • www.specialistfreightnetworkshc.com
  • www.specialistfreightnetworkshbc.com
  • www.specialistfreightnetworkshc.com
  • www.specialistfreightnetworks.com
  • www.specialistfreightnetworksc.com
  • www.specialistfreightnetworksx.com
  • www.specialistfreightnetworksxc.com
  • www.specialistfreightnetworksx.com
  • www.specialistfreightnetworksf.com
  • www.specialistfreightnetworksfc.com
  • www.specialistfreightnetworksf.com
  • www.specialistfreightnetworksv.com
  • www.specialistfreightnetworksvc.com
  • www.specialistfreightnetworksv.com
  • www.specialistfreightnetworksd.com
  • www.specialistfreightnetworksdc.com
  • www.specialistfreightnetworksd.com
  • www.specialistfreightnetworkscb.com
  • www.specialistfreightnetworkscom
  • www.specialistfreightnetworks..com
  • www.specialistfreightnetworks/com
  • www.specialistfreightnetworks/.com
  • www.specialistfreightnetworks./com
  • www.specialistfreightnetworksncom
  • www.specialistfreightnetworksn.com
  • www.specialistfreightnetworks.ncom
  • www.specialistfreightnetworks;com
  • www.specialistfreightnetworks;.com
  • www.specialistfreightnetworks.;com
  • www.specialistfreightnetworkslcom
  • www.specialistfreightnetworksl.com
  • www.specialistfreightnetworks.lcom
  • www.specialistfreightnetworks com
  • www.specialistfreightnetworks .com
  • www.specialistfreightnetworks. com
  • www.specialistfreightnetworks,com
  • www.specialistfreightnetworks,.com
  • www.specialistfreightnetworks.,com
  • www.specialistfreightnetworksmcom
  • www.specialistfreightnetworksm.com
  • www.specialistfreightnetworks.mcom
  • www.specialistfreightnetworks.ccom
  • www.specialistfreightnetworks.om
  • www.specialistfreightnetworks.ccom
  • www.specialistfreightnetworks.xom
  • www.specialistfreightnetworks.xcom
  • www.specialistfreightnetworks.cxom
  • www.specialistfreightnetworks.fom
  • www.specialistfreightnetworks.fcom
  • www.specialistfreightnetworks.cfom
  • www.specialistfreightnetworks.vom
  • www.specialistfreightnetworks.vcom
  • www.specialistfreightnetworks.cvom
  • www.specialistfreightnetworks.dom
  • www.specialistfreightnetworks.dcom
  • www.specialistfreightnetworks.cdom
  • www.specialistfreightnetworksc.om
  • www.specialistfreightnetworks.cm
  • www.specialistfreightnetworks.coom
  • www.specialistfreightnetworks.cpm
  • www.specialistfreightnetworks.cpom
  • www.specialistfreightnetworks.copm
  • www.specialistfreightnetworks.cim
  • www.specialistfreightnetworks.ciom
  • www.specialistfreightnetworks.coim
  • www.specialistfreightnetworks.ckm
  • www.specialistfreightnetworks.ckom
  • www.specialistfreightnetworks.cokm
  • www.specialistfreightnetworks.clm
  • www.specialistfreightnetworks.clom
  • www.specialistfreightnetworks.colm
  • www.specialistfreightnetworks.c0m
  • www.specialistfreightnetworks.c0om
  • www.specialistfreightnetworks.co0m
  • www.specialistfreightnetworks.c:m
  • www.specialistfreightnetworks.c:om
  • www.specialistfreightnetworks.co:m
  • www.specialistfreightnetworks.c9m
  • www.specialistfreightnetworks.c9om
  • www.specialistfreightnetworks.co9m
  • www.specialistfreightnetworks.ocm
  • www.specialistfreightnetworks.co
  • specialistfreightnetworks.comm
  • www.specialistfreightnetworks.con
  • www.specialistfreightnetworks.conm
  • specialistfreightnetworks.comn
  • www.specialistfreightnetworks.col
  • www.specialistfreightnetworks.colm
  • specialistfreightnetworks.coml
  • www.specialistfreightnetworks.co
  • www.specialistfreightnetworks.co m
  • specialistfreightnetworks.com
  • www.specialistfreightnetworks.cok
  • www.specialistfreightnetworks.cokm
  • specialistfreightnetworks.comk
  • www.specialistfreightnetworks.co,
  • www.specialistfreightnetworks.co,m
  • specialistfreightnetworks.com,
  • www.specialistfreightnetworks.coj
  • www.specialistfreightnetworks.cojm
  • specialistfreightnetworks.comj
  • www.specialistfreightnetworks.cmo
Show All Mistakes Hide All Mistakes